No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00079977-A01 |
Product name: | GRHL2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GRHL2. |
Gene id: | 79977 |
Gene name: | GRHL2 |
Gene alias: | BOM|DFNA28|FLJ11172|FLJ13782|MGC149294|MGC149295|TFCP2L3 |
Gene description: | grainyhead-like 2 (Drosophila) |
Genbank accession: | NM_024915 |
Immunogen: | GRHL2 (NP_079191, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS |
Protein accession: | NP_079191 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Human Papillomavirus 16 E6 Induces FoxM1B in Oral Keratinocytes through GRHL2.Chen W, Shimane T, Kawano S, Alshaikh A, Kim SY, Chung SH, Kim RH, Shin KH, Walentin K, Park NH, Schmidt-Ott KM, Kang MK. J Dent Res. 2018 Feb 1:22034518756071. |