FLJ13236 purified MaxPab mouse polyclonal antibody (B01P) View larger

FLJ13236 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ13236 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FLJ13236 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079962-B01P
Product name: FLJ13236 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FLJ13236 protein.
Gene id: 79962
Gene name: DNAJC22
Gene alias: FLJ13236|wus
Gene description: DnaJ (Hsp40) homolog, subfamily C, member 22
Genbank accession: NM_024902
Immunogen: FLJ13236 (NP_079178.2, 1 a.a. ~ 341 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR
Protein accession: NP_079178.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079962-B01P-13-15-1.jpg
Application image note: Western Blot analysis of DNAJC22 expression in transfected 293T cell line (H00079962-T02) by DNAJC22 MaxPab polyclonal antibody.

Lane 1: FLJ13236 transfected lysate(37.51 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLJ13236 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart