| Brand: | Abnova |
| Reference: | H00079949-M07 |
| Product name: | C10orf81 monoclonal antibody (M07), clone 3B6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant C10orf81. |
| Clone: | 3B6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 79949 |
| Gene name: | C10orf81 |
| Gene alias: | FLJ23537|HEL185|bA211N11.2 |
| Gene description: | chromosome 10 open reading frame 81 |
| Genbank accession: | BC036365 |
| Immunogen: | C10orf81 (AAH36365, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE |
| Protein accession: | AAH36365 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (56.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | C10orf81 monoclonal antibody (M07), clone 3B6. Western Blot analysis of C10orf81 expression in Jurkat(Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |