C10orf81 purified MaxPab mouse polyclonal antibody (B01P) View larger

C10orf81 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C10orf81 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about C10orf81 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00079949-B01P
Product name: C10orf81 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C10orf81 protein.
Gene id: 79949
Gene name: C10orf81
Gene alias: FLJ23537|HEL185|bA211N11.2
Gene description: chromosome 10 open reading frame 81
Genbank accession: BC036365
Immunogen: C10orf81 (AAH36365, 1 a.a. ~ 282 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE
Protein accession: AAH36365
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079949-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C10orf81 expression in transfected 293T cell line (H00079949-T01) by C10orf81 MaxPab polyclonal antibody.

Lane 1: C10orf81 transfected lysate(31.13 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C10orf81 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart