DHDDS MaxPab mouse polyclonal antibody (B01) View larger

DHDDS MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHDDS MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DHDDS MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00079947-B01
Product name: DHDDS MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DHDDS protein.
Gene id: 79947
Gene name: DHDDS
Gene alias: CIT|CPT|DS|FLJ13102|HDS
Gene description: dehydrodolichyl diphosphate synthase
Genbank accession: BC004117.2
Immunogen: DHDDS (AAH04117.1, 1 a.a. ~ 294 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA
Protein accession: AAH04117.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079947-B01-13-15-1.jpg
Application image note: Western Blot analysis of DHDDS expression in transfected 293T cell line (H00079947-T01) by DHDDS MaxPab polyclonal antibody.

Lane 1: DHDDS transfected lysate(32.34 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DHDDS MaxPab mouse polyclonal antibody (B01) now

Add to cart