No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00079925-M01A |
| Product name: | FLJ23577 monoclonal antibody (M01A), clone 4B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FLJ23577. |
| Clone: | 4B10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79925 |
| Gene name: | SPEF2 |
| Gene alias: | FLJ23164|FLJ23577|FLJ25395|KIAA1770|KPL2|MGC102842 |
| Gene description: | sperm flagellar 2 |
| Genbank accession: | NM_024867 |
| Immunogen: | FLJ23577 (NP_079143, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY |
| Protein accession: | NP_079143 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |