Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CBLL1 monoclonal antibody (M02), clone 3B12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
More info about CBLL1 monoclonal antibody (M02), clone 3B12
| Brand: | Abnova |
| Reference: | H00079872-M02 |
| Product name: | CBLL1 monoclonal antibody (M02), clone 3B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CBLL1. |
| Clone: | 3B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79872 |
| Gene name: | CBLL1 |
| Gene alias: | FLJ23109|HAKAI|MGC163401|MGC163403|RNF188 |
| Gene description: | Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1 |
| Genbank accession: | NM_024814 |
| Immunogen: | CBLL1 (NP_079090, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGE |
| Protein accession: | NP_079090 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CBLL1 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |