| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00079837-M01A |
| Product name: | PIP4K2C monoclonal antibody (M01A), clone 3A4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIP4K2C. |
| Clone: | 3A4 |
| Isotype: | IgG |
| Gene id: | 79837 |
| Gene name: | PIP4K2C |
| Gene alias: | FLJ22055|PIP5K2C |
| Gene description: | phosphatidylinositol-5-phosphate 4-kinase, type II, gamma |
| Genbank accession: | NM_024779 |
| Immunogen: | PIP4K2C (NP_079055.2, 310 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDA |
| Protein accession: | NP_079055.2 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of PIP4K2C expression in transfected 293T cell line by PIP4K2C monoclonal antibody (M01A), clone 3A4. Lane 1: PIP4K2C transfected lysate (Predicted MW: 47.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |