| Brand: | Abnova |
| Reference: | H00079833-M08 |
| Product name: | GEMIN6 monoclonal antibody (M08), clone 3D2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GEMIN6. |
| Clone: | 3D2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 79833 |
| Gene name: | GEMIN6 |
| Gene alias: | FLJ23459 |
| Gene description: | gem (nuclear organelle) associated protein 6 |
| Genbank accession: | BC018195 |
| Immunogen: | GEMIN6 (AAH18195, 1 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ |
| Protein accession: | AAH18195 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GEMIN6 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |