TLE6 monoclonal antibody (M01), clone 2E4 View larger

TLE6 monoclonal antibody (M01), clone 2E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLE6 monoclonal antibody (M01), clone 2E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about TLE6 monoclonal antibody (M01), clone 2E4

Brand: Abnova
Reference: H00079816-M01
Product name: TLE6 monoclonal antibody (M01), clone 2E4
Product description: Mouse monoclonal antibody raised against a full length recombinant TLE6.
Clone: 2E4
Isotype: IgG1 Kappa
Gene id: 79816
Gene name: TLE6
Gene alias: FLJ14009|GRG6|MGC14966
Gene description: transducin-like enhancer of split 6 (E(sp1) homolog, Drosophila)
Genbank accession: BC020206
Immunogen: TLE6 (AAH20206, 1 a.a. ~ 449 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATRSSDWLRRPLGEDNQPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDRQQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGSQDRNTSWGVVQEPPGRASRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKMRILAHGELVLATAISSFTRHVFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVSVWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGYPDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMANGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVPEMSPVTCCDVSSNNRLVVTGSGEHASVYQITY
Protein accession: AAH20206
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079816-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (75.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00079816-M01-13-15-1.jpg
Application image note: Western Blot analysis of TLE6 expression in transfected 293T cell line by TLE6 monoclonal antibody (M01), clone 2E4.

Lane 1: TLE6 transfected lysate (Predicted MW: 49.8 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Transcription factors FOXG1 and Groucho/TLE promote glioblastoma growth.Verginelli F, Perin A, Dali R, Fung KH, Lo R, Longatti P, Guiot MC, Del Maestro RF, Rossi S, di Porzio U, Stechishin O, Weiss S, Stifani S
Nat Commun. 2013 Dec 20;4:2956. doi: 10.1038/ncomms3956.

Reviews

Buy TLE6 monoclonal antibody (M01), clone 2E4 now

Add to cart