| Brand: | Abnova |
| Reference: | H00079813-M05 |
| Product name: | EHMT1 monoclonal antibody (M05), clone 3G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EHMT1. |
| Clone: | 3G1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79813 |
| Gene name: | EHMT1 |
| Gene alias: | DEL9q34|DKFZp667M072|EUHMTASE1|Eu-HMTase1|FLJ12879|FP13812|GLP|KIAA1876|KMT1D|bA188C12.1 |
| Gene description: | euchromatic histone-lysine N-methyltransferase 1 |
| Genbank accession: | NM_024757 |
| Immunogen: | EHMT1 (NP_079033, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA |
| Protein accession: | NP_079033 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to EHMT1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |