| Brand: | Abnova |
| Reference: | H00079791-M01 |
| Product name: | FBXO31 monoclonal antibody (M01), clone 1C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXO31. |
| Clone: | 1C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 79791 |
| Gene name: | FBXO31 |
| Gene alias: | DKFZp434B027|DKFZp434J1815|FBX14|FBXO14|FLJ22477|Fbx31|MGC15419|MGC9527|pp2386 |
| Gene description: | F-box protein 31 |
| Genbank accession: | NM_024735 |
| Immunogen: | FBXO31 (NP_079011.3, 269 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS |
| Protein accession: | NP_079011.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FBXO31 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |