ZFHX4 polyclonal antibody (A01) View larger

ZFHX4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFHX4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZFHX4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00079776-A01
Product name: ZFHX4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Gene id: 79776
Gene name: ZFHX4
Gene alias: FLJ16514|FLJ20980|ZFH-4|ZFH4|ZHF4
Gene description: zinc finger homeobox 4
Genbank accession: NM_024721
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 93 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ
Protein accession: NP_078997
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00079776-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.23 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Contrasting proteome biology and functional heterogeneity of the 20S proteasome complexes in mammalian tissues.Gomes AV, Young GW, Wang Y, Zong C, Eghbali M, Drews O, Lu H, Stefani E, Ping P.
Mol Cell Proteomics. 2009 Feb;8(2):302-15. Epub 2008 Oct 17.

Reviews

Buy ZFHX4 polyclonal antibody (A01) now

Add to cart