No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00079776-A01 |
| Product name: | ZFHX4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ZFHX4. |
| Gene id: | 79776 |
| Gene name: | ZFHX4 |
| Gene alias: | FLJ16514|FLJ20980|ZFH-4|ZFH4|ZHF4 |
| Gene description: | zinc finger homeobox 4 |
| Genbank accession: | NM_024721 |
| Immunogen: | ZFHX4 (NP_078997, 2 a.a. ~ 93 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ |
| Protein accession: | NP_078997 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Contrasting proteome biology and functional heterogeneity of the 20S proteasome complexes in mammalian tissues.Gomes AV, Young GW, Wang Y, Zong C, Eghbali M, Drews O, Lu H, Stefani E, Ping P. Mol Cell Proteomics. 2009 Feb;8(2):302-15. Epub 2008 Oct 17. |