GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P) View larger

GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,IF,WB-Tr

More info about GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00079760-D01P
Product name: GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human GEMIN7 protein.
Gene id: 79760
Gene name: GEMIN7
Gene alias: SIP3
Gene description: gem (nuclear organelle) associated protein 7
Genbank accession: NM_001007269.1
Immunogen: GEMIN7 (NP_001007270.1, 1 a.a. ~ 131 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Protein accession: NP_001007270.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00079760-D01P-13-15-1.jpg
Application image note: Western Blot analysis of GEMIN7 expression in transfected 293T cell line (H00079760-T03) by GEMIN7 MaxPab polyclonal antibody.

Lane 1: GEMIN7 transfected lysate(14.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart