Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00079760-D01P |
Product name: | GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human GEMIN7 protein. |
Gene id: | 79760 |
Gene name: | GEMIN7 |
Gene alias: | SIP3 |
Gene description: | gem (nuclear organelle) associated protein 7 |
Genbank accession: | NM_001007269.1 |
Immunogen: | GEMIN7 (NP_001007270.1, 1 a.a. ~ 131 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP |
Protein accession: | NP_001007270.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of GEMIN7 expression in transfected 293T cell line (H00079760-T03) by GEMIN7 MaxPab polyclonal antibody. Lane 1: GEMIN7 transfected lysate(14.50 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |