| Brand: | Abnova |
| Reference: | H00079754-M01 |
| Product name: | ASB13 monoclonal antibody (M01), clone 2A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ASB13. |
| Clone: | 2A11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 79754 |
| Gene name: | ASB13 |
| Gene alias: | FLJ13134|MGC19879 |
| Gene description: | ankyrin repeat and SOCS box-containing 13 |
| Genbank accession: | BC012056 |
| Immunogen: | ASB13 (AAH12056, 74 a.a. ~ 173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAA |
| Protein accession: | AAH12056 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |