Brand: | Abnova |
Reference: | H00079706-M08 |
Product name: | PRKRIP1 monoclonal antibody (M08), clone M2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PRKRIP1. |
Clone: | M2 |
Isotype: | IgG1 Kappa |
Gene id: | 79706 |
Gene name: | PRKRIP1 |
Gene alias: | C114|FLJ13902|FLJ40957 |
Gene description: | PRKR interacting protein 1 (IL11 inducible) |
Genbank accession: | BC014298 |
Immunogen: | PRKRIP1 (AAH14298, 1 a.a. ~ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR |
Protein accession: | AAH14298 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PRKRIP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 5 ug/ml] |
Applications: | IHC-P,ELISA |
Shipping condition: | Dry Ice |