| Brand: | Abnova |
| Reference: | H00079706-M02 |
| Product name: | PRKRIP1 monoclonal antibody (M02), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PRKRIP1. |
| Clone: | 3B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 79706 |
| Gene name: | PRKRIP1 |
| Gene alias: | C114|FLJ13902|FLJ40957 |
| Gene description: | PRKR interacting protein 1 (IL11 inducible) |
| Genbank accession: | BC014298 |
| Immunogen: | PRKRIP1 (AAH14298, 1 a.a. ~ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR |
| Protein accession: | AAH14298 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.98 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged PRKRIP1 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |