No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,IP |
Brand: | Abnova |
Reference: | H00079705-M03 |
Product name: | LRRK1 monoclonal antibody (M03), clone 3G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LRRK1. |
Clone: | 3G8 |
Isotype: | IgG1 Kappa |
Gene id: | 79705 |
Gene name: | LRRK1 |
Gene alias: | FLJ23119|FLJ27465|KIAA1790|RIPK6|Roco1 |
Gene description: | leucine-rich repeat kinase 1 |
Genbank accession: | BC005408 |
Immunogen: | LRRK1 (AAH05408, 560 a.a. ~ 659 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIWVPRRGGDVIVIGLEKDSEAQRGRVIAVLKARELTPHGIMPVSSVKVCWAGWPVRDMVYMAAVM |
Protein accession: | AAH05408 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged LRRK1 is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |