| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00079698-M02 |
| Product name: | ZMAT4 monoclonal antibody (M02), clone 2A4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ZMAT4. |
| Clone: | 2A4 |
| Isotype: | IgG1 kappa |
| Gene id: | 79698 |
| Gene name: | ZMAT4 |
| Gene alias: | FLJ13842 |
| Gene description: | zinc finger, matrin type 4 |
| Genbank accession: | BC019598 |
| Immunogen: | ZMAT4 (AAH19598, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK |
| Protein accession: | AAH19598 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ZMAT4 expression in transfected 293T cell line by ZMAT4 monoclonal antibody (M02), clone 2A4. Lane 1: ZMAT4 transfected lysate(17.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |