Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMC6L1 monoclonal antibody (M01), clone 2E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA |
More info about SMC6L1 monoclonal antibody (M01), clone 2E6
| Brand: | Abnova |
| Reference: | H00079677-M01 |
| Product name: | SMC6L1 monoclonal antibody (M01), clone 2E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMC6L1. |
| Clone: | 2E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79677 |
| Gene name: | SMC6 |
| Gene alias: | FLJ22116|FLJ35534|SMC6L1 |
| Gene description: | structural maintenance of chromosomes 6 |
| Genbank accession: | BC039828 |
| Immunogen: | SMC6L1 (AAH39828, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFV |
| Protein accession: | AAH39828 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SMC6L1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Smc5/6-mediated regulation of replication progression contributes to chromosome assembly during mitosis in human cells.Gallego-Paez LM, Tanaka H, Bando M, Takahashi M, Nozaki N, Nakato R, Shirahige K, Hirota T Mol Biol Cell. 2014 Jan;25(2):302-17. doi: 10.1091/mbc.E13-01-0020. Epub 2013 Nov 20. |