| Brand: | Abnova |
| Reference: | H00079623-M01 |
| Product name: | GALNT14 monoclonal antibody (M01), clone 2A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GALNT14. |
| Clone: | 2A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79623 |
| Gene name: | GALNT14 |
| Gene alias: | FLJ12691|FLJ13977|GALNT15|GalNac-T10|GalNac-T14 |
| Gene description: | UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 14 (GalNAc-T14) |
| Genbank accession: | NM_024572 |
| Immunogen: | GALNT14 (NP_078848.2, 494 a.a. ~ 551 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCESSLMSQHWDMVS |
| Protein accession: | NP_078848.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GALNT14 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |