| Brand: | Abnova |
| Reference: | H00079603-M03 |
| Product name: | LASS4 monoclonal antibody (M03), clone 7D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LASS4. |
| Clone: | 7D5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79603 |
| Gene name: | LASS4 |
| Gene alias: | CerS4|FLJ12089|Trh1 |
| Gene description: | LAG1 homolog, ceramide synthase 4 |
| Genbank accession: | NM_024552 |
| Immunogen: | LASS4 (NP_078828, 57 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR |
| Protein accession: | NP_078828 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to LASS4 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |