Cart 1 Product Products 374,00 € (empty)
No products
To be determined Shipping
374,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 374,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 374,00 €
Data sheet of BIRC7 monoclonal antibody (M05), clone 3H1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
More info about BIRC7 monoclonal antibody (M05), clone 3H1
| Brand: | Abnova |
| Reference: | H00079444-M05 |
| Product name: | BIRC7 monoclonal antibody (M05), clone 3H1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BIRC7. |
| Clone: | 3H1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 79444 |
| Gene name: | BIRC7 |
| Gene alias: | KIAP|LIVIN|ML-IAP|MLIAP|RNF50 |
| Gene description: | baculoviral IAP repeat-containing 7 |
| Genbank accession: | NM_139317 |
| Immunogen: | BIRC7 (NP_647478.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR |
| Protein accession: | NP_647478.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged BIRC7 is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |