No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00079365-M01 |
| Product name: | BHLHB3 monoclonal antibody (M01), clone 4H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BHLHB3. |
| Clone: | 4H6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 79365 |
| Gene name: | BHLHE41 |
| Gene alias: | BHLHB3|DEC2|SHARP-1|SHARP1 |
| Gene description: | basic helix-loop-helix family, member e41 |
| Genbank accession: | NM_030762 |
| Immunogen: | BHLHB3 (NP_110389, 203 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL |
| Protein accession: | NP_110389 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to BHLHE41 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A new role for SREBP-1 transcription factors in the regulation of muscle mass and muscle cell differentiation.Lecomte V, Meugnier E, Euthine V, Durand C, Freyssenet D, Nemoz G, Rome S, Vidal H, Lefai E. Mol Cell Biol. 2009 Dec 22. [Epub ahead of print] |