| Brand: | Abnova |
| Reference: | H00079192-A01 |
| Product name: | IRX1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IRX1. |
| Gene id: | 79192 |
| Gene name: | IRX1 |
| Gene alias: | IRX-5|IRXA1 |
| Gene description: | iroquois homeobox 1 |
| Genbank accession: | NM_024337 |
| Immunogen: | IRX1 (NP_077313, 424 a.a. ~ 479 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPS |
| Protein accession: | NP_077313 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.27 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IRX1 polyclonal antibody (A01), Lot # 051025JC01 Western Blot analysis of IRX1 expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene.Zougman A, Mann M, Wisniewski JR. Nucleic Acids Res. 2011 May 17. [Epub ahead of print] |