No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00079191-M03 |
Product name: | IRX3 monoclonal antibody (M03), clone 3D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IRX3. |
Clone: | 3D8 |
Isotype: | IgG2a Kappa |
Gene id: | 79191 |
Gene name: | IRX3 |
Gene alias: | IRX-1 |
Gene description: | iroquois homeobox 3 |
Genbank accession: | NM_024336 |
Immunogen: | IRX3 (NP_077312, 182 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI |
Protein accession: | NP_077312 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | IRX3 monoclonal antibody (M03), clone 3D8 Western Blot analysis of IRX3 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |