No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00079174-M03A |
| Product name: | CRELD2 monoclonal antibody (M03A), clone 2B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CRELD2. |
| Clone: | 2B6 |
| Isotype: | IgM Kappa |
| Gene id: | 79174 |
| Gene name: | CRELD2 |
| Gene alias: | DKFZp667O055|MGC11256 |
| Gene description: | cysteine-rich with EGF-like domains 2 |
| Genbank accession: | NM_024324 |
| Immunogen: | CRELD2 (NP_077300, 162 a.a. ~ 258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEE |
| Protein accession: | NP_077300 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |