View larger

MMP28 monoclonal antibody (M01), clone 3C11

Reference:

Condition: New product

Data sheet of MMP28 monoclonal antibody (M01), clone 3C11

Brand:	Abnova
Reference:	H00079148-M01
Product name:	MMP28 monoclonal antibody (M01), clone 3C11
Product description:	Mouse monoclonal antibody raised against a partial recombinant MMP28.
Clone:	3C11
Isotype:	IgG2a Kappa
Gene id:	79148
Gene name:	MMP28
Gene alias:	EPILYSIN\|MM28\|MMP-28\|MMP25
Gene description:	matrix metallopeptidase 28
Genbank accession:	NM_024302
Immunogen:	MMP28 (NP_077278, 441 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	LARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
Protein accession:	NP_077278
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (34.54 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged MMP28 is 0.03 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice