| Brand: | Abnova |
| Reference: | H00079031-M01 |
| Product name: | PDCL3 monoclonal antibody (M01), clone 1F10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PDCL3. |
| Clone: | 1F10 |
| Isotype: | IgG1 kappa |
| Gene id: | 79031 |
| Gene name: | PDCL3 |
| Gene alias: | HTPHLP|MGC3062|PHLP3|VIAF|VIAF1 |
| Gene description: | phosducin-like 3 |
| Genbank accession: | BC001021 |
| Immunogen: | PDCL3 (AAH01021, 1 a.a. ~ 239 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD |
| Protein accession: | AAH01021 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PDCL3 monoclonal antibody (M01), clone 1F10 Western Blot analysis of PDCL3 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |