BOLL monoclonal antibody (M05), clone 5B8 View larger

BOLL monoclonal antibody (M05), clone 5B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BOLL monoclonal antibody (M05), clone 5B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about BOLL monoclonal antibody (M05), clone 5B8

Brand: Abnova
Reference: H00066037-M05
Product name: BOLL monoclonal antibody (M05), clone 5B8
Product description: Mouse monoclonal antibody raised against a partial recombinant BOLL.
Clone: 5B8
Isotype: IgG2a Kappa
Gene id: 66037
Gene name: BOLL
Gene alias: -
Gene description: bol, boule-like (Drosophila)
Genbank accession: NM_033030
Immunogen: BOLL (NP_149019, 185 a.a. ~ 283 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Protein accession: NP_149019
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00066037-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00066037-M05-2-A1-1.jpg
Application image note: BOLL monoclonal antibody (M05), clone 5B8. Western Blot analysis of BOLL expression in human liver.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BOLL monoclonal antibody (M05), clone 5B8 now

Add to cart