BOLL MaxPab mouse polyclonal antibody (B01) View larger

BOLL MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BOLL MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,WB-Tr

More info about BOLL MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00066037-B01
Product name: BOLL MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human BOLL protein.
Gene id: 66037
Gene name: BOLL
Gene alias: -
Gene description: bol, boule-like (Drosophila)
Genbank accession: NM_197970.1
Immunogen: BOLL (NP_932074.1, 1 a.a. ~ 295 a.a) full-length human protein.
Immunogen sequence/protein sequence: METESGPQTSNQMQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Protein accession: NP_932074.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00066037-B01-13-15-1.jpg
Application image note: Western Blot analysis of BOLL expression in transfected 293T cell line (H00066037-T01) by BOLL MaxPab polyclonal antibody.

Lane 1: BOLL transfected lysate(32.45 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BOLL MaxPab mouse polyclonal antibody (B01) now

Add to cart