No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00066036-M01 |
| Product name: | MTMR9 monoclonal antibody (M01), clone 4A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MTMR9. |
| Clone: | 4A9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 66036 |
| Gene name: | MTMR9 |
| Gene alias: | C8orf9|DKFZp434K171|LIP-STYX|MGC126672|MTMR8 |
| Gene description: | myotubularin related protein 9 |
| Genbank accession: | NM_015458 |
| Immunogen: | MTMR9 (NP_056273, 450 a.a. ~ 549 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQQKTMSLWSWVNQPSELSKFTNPLFEANNLVIWPSVAPQSLPLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELETEDGMQESP |
| Protein accession: | NP_056273 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |