RASL11B MaxPab mouse polyclonal antibody (B01) View larger

RASL11B MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RASL11B MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RASL11B MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00065997-B01
Product name: RASL11B MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RASL11B protein.
Gene id: 65997
Gene name: RASL11B
Gene alias: MGC2827|MGC4499
Gene description: RAS-like, family 11, member B
Genbank accession: NM_023940
Immunogen: RASL11B (NP_076429, 1 a.a. ~ 248 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV
Protein accession: NP_076429
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00065997-B01-13-15-1.jpg
Application image note: Western Blot analysis of RASL11B expression in transfected 293T cell line (H00065997-T02) by RASL11B MaxPab polyclonal antibody.

Lane 1: RASL11B transfected lysate(27.28 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RASL11B MaxPab mouse polyclonal antibody (B01) now

Add to cart