FUNDC2 purified MaxPab mouse polyclonal antibody (B02P) View larger

FUNDC2 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FUNDC2 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about FUNDC2 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00065991-B02P
Product name: FUNDC2 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a partial human FUNDC2 protein.
Gene id: 65991
Gene name: FUNDC2
Gene alias: DC44|FLJ33773|HCBP6|HCC3|MGC131676|MGC2495|PD03104
Gene description: FUN14 domain containing 2
Genbank accession: NM_023934.3
Immunogen: FUNDC2 (NP_076423.2, 1 a.a. ~ 189 a.a) partial human protein.
Immunogen sequence/protein sequence: METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS
Protein accession: NP_076423.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00065991-B02P-13-15-1.jpg
Application image note: Western Blot analysis of FUNDC2 expression in transfected 293T cell line (H00065991-T02) by FUNDC2 MaxPab polyclonal antibody.

Lane 1: FUNDC2 transfected lysate(20.79 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FUNDC2 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart