| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00065989-B01P |
| Product name: | DLK2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human DLK2 protein. |
| Gene id: | 65989 |
| Gene name: | DLK2 |
| Gene alias: | EGFL9|MGC111055|MGC2487 |
| Gene description: | delta-like 2 homolog (Drosophila) |
| Genbank accession: | NM_023932 |
| Immunogen: | DLK2 (NP_076421.2, 1 a.a. ~ 383 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL |
| Protein accession: | NP_076421.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of DLK2 expression in transfected 293T cell line (H00065989-T02) by DLK2 MaxPab polyclonal antibody. Lane 1: EGFL9 transfected lysate(42.13 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The proteins DLK1 and DLK2 modulate NOTCH1-dependent proliferation and oncogenic potential of human SK-MEL-2 melanoma cells.Nueda ML, Naranjo AI, Baladron V, Laborda J Biochim Biophys Acta. 2014 Aug 2;1843(11):2674-2684. doi: 10.1016/j.bbamcr.2014.07.015. |