NOL6 purified MaxPab mouse polyclonal antibody (B01P) View larger

NOL6 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NOL6 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about NOL6 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00065083-B01P
Product name: NOL6 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NOL6 protein.
Gene id: 65083
Gene name: NOL6
Gene alias: FLJ21959|MGC14896|MGC14921|MGC20838|NRAP|UTP22|bA311H10.1
Gene description: nucleolar protein family 6 (RNA-associated)
Genbank accession: BC008298
Immunogen: NOL6 (AAH08298, 1 a.a. ~ 200 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Protein accession: AAH08298
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00065083-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NOL6 expression in transfected 293T cell line (H00065083-T01) by NOL6 MaxPab polyclonal antibody.

Lane 1: NOL6 transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NOL6 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart