Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00065083-B01 |
Product name: | NOL6 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human NOL6 protein. |
Gene id: | 65083 |
Gene name: | NOL6 |
Gene alias: | FLJ21959|MGC14896|MGC14921|MGC20838|NRAP|UTP22|bA311H10.1 |
Gene description: | nucleolar protein family 6 (RNA-associated) |
Genbank accession: | BC008298 |
Immunogen: | NOL6 (AAH08298, 1 a.a. ~ 200 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV |
Protein accession: | AAH08298 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NOL6 expression in transfected 293T cell line (H00065083-T01) by NOL6 MaxPab polyclonal antibody. Lane 1: NOL6 transfected lysate(22.11 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |