Brand: | Abnova |
Reference: | H00065061-A01 |
Product name: | ALS2CR7 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ALS2CR7. |
Gene id: | 65061 |
Gene name: | PFTK2 |
Gene alias: | ALS2CR7 |
Gene description: | PFTAIRE protein kinase 2 |
Genbank accession: | NM_139158 |
Immunogen: | ALS2CR7 (NP_631897, 242 a.a. ~ 347 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MFQGQPLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLP |
Protein accession: | NP_631897 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | ALS2CR7 polyclonal antibody (A01), Lot # 051130JCO1 Western Blot analysis of ALS2CR7 expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |