Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NDRG4 monoclonal antibody (M01), clone 2G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about NDRG4 monoclonal antibody (M01), clone 2G3
| Brand: | Abnova |
| Reference: | H00065009-M01 |
| Product name: | NDRG4 monoclonal antibody (M01), clone 2G3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NDRG4. |
| Clone: | 2G3 |
| Isotype: | IgG1 kappa |
| Gene id: | 65009 |
| Gene name: | NDRG4 |
| Gene alias: | DKFZp686I1615|FLJ30586|FLJ42011|KIAA1180|MGC19632|SMAP-8 |
| Gene description: | NDRG family member 4 |
| Genbank accession: | BC011795 |
| Immunogen: | NDRG4 (AAH11795.1, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC |
| Protein accession: | AAH11795.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (63.03 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | NDRG4 monoclonal antibody (M01), clone 2G3. Western Blot analysis of NDRG4 expression in Raw 264.7. |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Uterine Expression of NDRG4 Is Induced by Estrogen and Up-Regulated during Embryo Implantation Process in Mice.Yang Q, Gu Y, Zhang X, Wang JM, He YP, Shi Y, Sun ZG, Shi HJ, Wang J. PLoS One. 2016 May 13;11(5):e0155491. |