Cart 9 Product Products 2 230,49 € (empty)
No products
To be determined Shipping
2 230,49 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 230,49 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 230,49 €
Data sheet of GNPNAT1 monoclonal antibody (M10), clone 1E9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about GNPNAT1 monoclonal antibody (M10), clone 1E9
| Brand: | Abnova |
| Reference: | H00064841-M10 |
| Product name: | GNPNAT1 monoclonal antibody (M10), clone 1E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GNPNAT1. |
| Clone: | 1E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64841 |
| Gene name: | GNPNAT1 |
| Gene alias: | FLJ10607|GNPNAT|Gpnat1 |
| Gene description: | glucosamine-phosphate N-acetyltransferase 1 |
| Genbank accession: | NM_198066 |
| Immunogen: | GNPNAT1 (NP_932332, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVE |
| Protein accession: | NP_932332 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to GNPNAT1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |