GNPNAT1 polyclonal antibody (A01) View larger

GNPNAT1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNPNAT1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GNPNAT1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00064841-A01
Product name: GNPNAT1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GNPNAT1.
Gene id: 64841
Gene name: GNPNAT1
Gene alias: FLJ10607|GNPNAT|Gpnat1
Gene description: glucosamine-phosphate N-acetyltransferase 1
Genbank accession: NM_198066
Immunogen: GNPNAT1 (NP_932332, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVE
Protein accession: NP_932332
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00064841-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00064841-A01-1-1-1.jpg
Application image note: GNPNAT1 polyclonal antibody (A01), Lot # 051116JC01 Western Blot analysis of GNPNAT1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GNPNAT1 polyclonal antibody (A01) now

Add to cart