No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00064839-M01 |
| Product name: | FBXL17 monoclonal antibody (M01), clone 6C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXL17. |
| Clone: | 6C12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 64839 |
| Gene name: | FBXL17 |
| Gene alias: | DKFZp434C1715|FBXO13|Fbl17|Fbx13|MGC161422|MGC161424 |
| Gene description: | F-box and leucine-rich repeat protein 17 |
| Genbank accession: | NM_022824 |
| Immunogen: | FBXL17 (NP_073735, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS |
| Protein accession: | NP_073735 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |