LMF1 purified MaxPab mouse polyclonal antibody (B01P) View larger

LMF1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LMF1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LMF1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064788-B01P
Product name: LMF1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human LMF1 protein.
Gene id: 64788
Gene name: LMF1
Gene alias: C16orf26|FLJ12681|FLJ22302|HMFN1876|JFP11|TMEM112|TMEM112A
Gene description: lipase maturation factor 1
Genbank accession: BC156645.1
Immunogen: LMF1 (AAI56646.1, 1 a.a. ~ 567 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLVAFHQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLETGFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAGLIKIRGDRCWRDLTCMDFHYETQPMPNPVAYYLHHSPWWFHRFETLSNHFIELLVPFFLFLGRRACIIHGVLQILFQAVLIVSGNLSFLNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFGSVVRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVILQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWIIHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRIGAYFPPLSLEELRPYFRDRGWPLPGPL
Protein accession: AAI56646.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064788-B01P-13-15-1.jpg
Application image note: Western Blot analysis of LMF1 expression in transfected 293T cell line (H00064788-T02) by LMF1 MaxPab polyclonal antibody.

Lane 1: LMF1 transfected lysate(62.37 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LMF1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart