Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EPS8L2 monoclonal antibody (M01), clone 6C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about EPS8L2 monoclonal antibody (M01), clone 6C2
| Brand: | Abnova |
| Reference: | H00064787-M01 |
| Product name: | EPS8L2 monoclonal antibody (M01), clone 6C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPS8L2. |
| Clone: | 6C2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 64787 |
| Gene name: | EPS8L2 |
| Gene alias: | EPS8R2|FLJ16738|FLJ21935|FLJ22171|MGC126530|MGC3088 |
| Gene description: | EPS8-like 2 |
| Genbank accession: | NM_022772 |
| Immunogen: | EPS8L2 (NP_073609, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED |
| Protein accession: | NP_073609 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | EPS8L2 monoclonal antibody (M01), clone 6C2 Western Blot analysis of EPS8L2 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Isolation and identification of potential urinary microparticle biomarkers of bladder cancer.Smalley DM, Sheman NE, Nelson K, Theodorescu D. J Proteome Res. 2008 May;7(5):2088-96. Epub 2008 Mar 29. |