No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00064783-M19 |
| Product name: | RBM15 monoclonal antibody (M19), clone 2C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RBM15. |
| Clone: | 2C1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 64783 |
| Gene name: | RBM15 |
| Gene alias: | FLJ12479|FLJ21943|MGC119584|OTT|OTT1|SPEN |
| Gene description: | RNA binding motif protein 15 |
| Genbank accession: | NM_022768 |
| Immunogen: | RBM15 (NP_073605.4, 701 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL |
| Protein accession: | NP_073605.4 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged RBM15 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |