Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IPPK polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about IPPK polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00064768-A01 |
| Product name: | IPPK polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant IPPK. |
| Gene id: | 64768 |
| Gene name: | IPPK |
| Gene alias: | C9orf12|FLJ13163|INSP5K2|IP5K|IPK1|KIAA0699|bA476B13.1 |
| Gene description: | inositol 1,3,4,5,6-pentakisphosphate 2-kinase |
| Genbank accession: | NM_022755 |
| Immunogen: | IPPK (NP_073592, 391 a.a. ~ 491 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VQQYRVAMTAKDCSIMIALSPCLQDASSDQRPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHKV |
| Protein accession: | NP_073592 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Urinary Peptidome May Predict Renal Function Decline in Type 1 Diabetes and Microalbuminuria.Merchant ML, Perkins BA, Boratyn GM, Ficociello LH, Wilkey DW, Barati MT, Bertram CC, Page GP, Rovin BH, Warram JH, Krolewski AS, Klein JB. J Am Soc Nephrol. 2009 Sep;20(9):2065-74. Epub 2009 Jul 30. |