Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00064718-B01P |
Product name: | UNKL purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human UNKL protein. |
Gene id: | 64718 |
Gene name: | UNKL |
Gene alias: | C16orf28|FLJ12623|FLJ23360|KIAA0734|MGC5179|ZC3H5L|ZC3HDC5L |
Gene description: | unkempt homolog (Drosophila)-like |
Genbank accession: | NM_001037125 |
Immunogen: | UNKL (NP_001032202, 1 a.a. ~ 277 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRDGTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYSWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA |
Protein accession: | NP_001032202 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of UNKL expression in transfected 293T cell line by UNKL MaxPab polyclonal antibody. Lane 1: UNKL transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |