UNKL purified MaxPab mouse polyclonal antibody (B01P) View larger

UNKL purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UNKL purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about UNKL purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064718-B01P
Product name: UNKL purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human UNKL protein.
Gene id: 64718
Gene name: UNKL
Gene alias: C16orf28|FLJ12623|FLJ23360|KIAA0734|MGC5179|ZC3H5L|ZC3HDC5L
Gene description: unkempt homolog (Drosophila)-like
Genbank accession: NM_001037125
Immunogen: UNKL (NP_001032202, 1 a.a. ~ 277 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRDGTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYSWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA
Protein accession: NP_001032202
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064718-B01P-13-15-1.jpg
Application image note: Western Blot analysis of UNKL expression in transfected 293T cell line by UNKL MaxPab polyclonal antibody.

Lane 1: UNKL transfected lysate(30.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UNKL purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart