Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TMPRSS3 monoclonal antibody (M01), clone 2E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TMPRSS3 monoclonal antibody (M01), clone 2E1
| Brand: | Abnova |
| Reference: | H00064699-M01 |
| Product name: | TMPRSS3 monoclonal antibody (M01), clone 2E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TMPRSS3. |
| Clone: | 2E1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64699 |
| Gene name: | TMPRSS3 |
| Gene alias: | DFNB10|DFNB8|ECHOS1|TADG12 |
| Gene description: | transmembrane protease, serine 3 |
| Genbank accession: | NM_024022 |
| Immunogen: | TMPRSS3 (NP_076927, 119 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYS |
| Protein accession: | NP_076927 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A novel genome-based approach correlates TMPRSS3 overexpression in ovarian cancer with DNA hypomethylation.Guerrero K, Wang Z, Bachvarova M, Gregoire J, Renaud MC, Plante M, Bachvarov D. Gynecol Oncol. 2012 Mar 21. [Epub ahead of print] |