Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MOSPD3 monoclonal antibody (M05), clone 1H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about MOSPD3 monoclonal antibody (M05), clone 1H6
| Brand: | Abnova |
| Reference: | H00064598-M05 |
| Product name: | MOSPD3 monoclonal antibody (M05), clone 1H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MOSPD3. |
| Clone: | 1H6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64598 |
| Gene name: | MOSPD3 |
| Gene alias: | CDS3 |
| Gene description: | motile sperm domain containing 3 |
| Genbank accession: | NM_023948 |
| Immunogen: | MOSPD3 (NP_076438, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYP |
| Protein accession: | NP_076438 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MOSPD3 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Magnetic bead-based separation of sperm from buccal epithelial cells using a monoclonal antibody against MOSPD3.Li XB, Wang QS, Feng Y, Ning SH, Miao YY, Wang YQ, Li HW Int J Legal Med. 2014 Mar 4. |