TSPY2 purified MaxPab mouse polyclonal antibody (B01P) View larger

TSPY2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSPY2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TSPY2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064591-B01P
Product name: TSPY2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TSPY2 protein.
Gene id: 64591
Gene name: TSPY2
Gene alias: MGC103998|TSPYQ1
Gene description: testis specific protein, Y-linked 2
Genbank accession: XM_001127025
Immunogen: TSPY2 (NP_072095.1, 1 a.a. ~ 308 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS
Protein accession: NP_072095.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064591-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TSPY2 expression in transfected 293T cell line by TSPY2 MaxPab polyclonal antibody.

Lane 1: TSPY2 transfected lysate(33.88 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TSPY2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart